Skip to content
Monday, January 18, 2021

Books, Literature & Writing

For those of us with many words to share
Books, Literature & Writing
For those of us with many words to share

Tag: some

Literature

The Art of Distance No. 39

support January 5, 2021 No Comments becausedailydistanceeveryliterarypublicsomestillthings

Adolf Kaufmann, Sonnenuntergang in Winterlandschaft (Sunset in Winter Landscape), n.d., oil on canvas, 29 x 39 1/4″. Public domain, via Wikimedia Commons. Happy New Year!…

View More The Art of Distance No. 39
Book Review Videos

If You Like This Christmas Movie, Read This Book!

support December 24, 2020 No Comments bookbookscutefreelikereadsomeusing

Let’s get into the festive spirit and compare some Christmas movies and books! Bookmas Day 22 – https://youtu.be/xzHzqoStubA Bookmas Playlist – https://bit.ly/2JnV9sE *GET A FREE…

View More If You Like This Christmas Movie, Read This Book!
Book Review Videos

Surprising & Disappointing Reads of the Year!

support December 13, 2020 No Comments booksexpectedfreereviewsomeusingwereyear

Every year I have some books I live more than expected, or I don’t like as much as I expected to, so let’s talk about…

View More Surprising & Disappointing Reads of the Year!
Literature

The Art of Distance No. 36

support December 9, 2020 No Comments distanceissueplaysreadreviewsometheaterunlocked

In March, The Paris Review launched The Art of Distance, a newsletter highlighting unlocked archive pieces that resonate with the staff of the magazine, quarantine-appropriate writing on the Daily, resources…

View More The Art of Distance No. 36
Book Review Videos

Books To Put on Your Christmas Wishlist!

support December 5, 2020 No Comments bookbooksfreelistroyalsomeusingwishlistyour

Hello! Happy Bookmas Day 4! Let’s talk about some staples that should be on your wishlist this year. Bookmas Day 3 – https://youtu.be/Dzbjq3UawGc Bookmas Playlist…

View More Books To Put on Your Christmas Wishlist!
Literature

The Art of Distance No. 33

support November 10, 2020 No Comments alwaysfeelsfirstparisreadreviewrichsometheirthey

In March, The Paris Review launched The Art of Distance, a newsletter highlighting unlocked archive pieces that resonate with the staff of the magazine, quarantine-appropriate writing on the Daily, resources…

View More The Art of Distance No. 33
Literature

Staff Picks: People, Places, and Poems

support November 7, 2020 No Comments beenfoundhistoryitrsquoslikemomentonlypoemsomeyoung

Kevin Young. Photo: Melanie Dunea. The making of history is on everyone’s mind this week. And while it’s hard to look away from that history…

View More Staff Picks: People, Places, and Poems
Literature

Staff Picks: Splorts, Seers, and Sentences

support November 3, 2020 No Comments awkwardbeenlikerightsometheretheyweekwork

Brian Dillon. I would have been happy to read Brian Dillon’s Suppose a Sentence at any time, but that the book came out in this…

View More Staff Picks: Splorts, Seers, and Sentences
Book Reviews

A Beginner’s Guide to Gothic Fantasy

support October 23, 2020 No Comments creepydarkfantasyfindsgothicnovelsisterssomethemwitch

With spooky season upon us, many of us are craving some dark and creepy reads. And some readers, regardless of season, are always on the…

View More A Beginner’s Guide to Gothic Fantasy
Writing

How to Start Writing Again When You Haven’t in a While

support August 20, 2020 No Comments don8217tfeelgoingpeoplesomestarttimewritewritingyour

If you’ve taken some time off from writing, whether that be a week or a year, we’ve got some tips to help you get writing…

View More How to Start Writing Again When You Haven’t in a While

Posts navigation

Page 1 Page 2 Page 3 Next page

Recent Posts

  • 6 Famous Libraries That Were Tragically Destroyed
  • Read Harder: A Historical Fiction With a POC or LGBTQ+ Protagonist
  • A Brief History of Word Games
  • Simon & Schuster Cancels Senator Josh Hawley’s Contract
  • Staff Picks: Heaven, Hearing Trumpets, and Hong Sang-soo

Recent Comments

    Archives

    • January 2021
    • December 2020
    • November 2020
    • October 2020
    • September 2020
    • August 2020
    • July 2020
    • June 2020
    • May 2020
    • April 2020
    • March 2020
    • February 2020
    • January 2020
    • December 2019
    • November 2019
    • October 2019
    • September 2019
    • August 2019
    • July 2019
    • June 2019
    • May 2019
    • April 2019
    • March 2019
    • February 2019
    • January 2019
    • December 2018

    Categories

    • Book Review Videos
    • Book Reviews
    • Literature
    • Uncategorized
    • Writing
    • Writing Videos

    Meta

    • Log in
    • Entries RSS
    • Comments RSS
    • WordPress.org
    Books, Literature & Writing | Designed by: Theme Freesia | WordPress | © Copyright All right reserved